PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g035490.1
Common NameMTR_1g035490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 333aa    MW: 38483.5 Da    PI: 9.0618
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g035490.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.31.6e-14102197299
                      EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
               B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      f v ++ ++++   l++p kf +eh ++ +++ t+++ +e++ + ++++    ++++   ++GWk F +  +L++ D++ F++++r+ f+++v+
  Medtr1g035490.1 102 FVVIMTQSYTNGYFLWVPSKFSREHLNNFKGTATIRVGNERSVEVSLRY--YDTKDKSCVGGGWKIFREKYNLQVDDVCKFEMIQRRPFSFTVT 193
                      55555666666666***********655446556666665555555555..55555556788*******************************9 PP

                      EE-S CS
               B3  96 vfrk 99 
                      + r+
  Medtr1g035490.1 194 ITRA 197
                      9886 PP

2B337.25.3e-122483291298
                      HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      k++  ++pk+f++  g++++    ++      +sW vk++y  +  +  + kGW++F ++ +++ gD+++F l+++++f + v+++ 
  Medtr1g035490.1 248 KNKAPSVPKEFMK-KGSNEN----IVELKMGRKSWFVKVNYYESVHGWRFNKGWRKFMEECKVEIGDTCLFNLIDERKFVFDVSIIG 329
                      44556899***94.444432....33333455*******9999999999*************************9999988777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-1897197IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.33E-1898196IPR015300DNA-binding pseudobarrel domain
CDDcd100174.30E-15100196No hitNo description
PROSITE profilePS5086310.165101198IPR003340B3 DNA binding domain
PfamPF023622.4E-12102197IPR003340B3 DNA binding domain
SMARTSM010192.9E-9102198IPR003340B3 DNA binding domain
PROSITE profilePS5086310.08237331IPR003340B3 DNA binding domain
SMARTSM010190.0024242331IPR003340B3 DNA binding domain
PfamPF023626.2E-9248328IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-12251330IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.35E-10253326IPR015300DNA-binding pseudobarrel domain
CDDcd100172.51E-9253328No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MKNELICIIN FTYYLKAFDE GAEEGESSDD EATEEDQESD ESSDESSYED EMPKQARRRT  60
RNGKRKVSMD FDTTQPKFSG SKKVAMVKKA RKYPTVNENP FFVVIMTQSY TNGYFLWVPS  120
KFSREHLNNF KGTATIRVGN ERSVEVSLRY YDTKDKSCVG GGWKIFREKY NLQVDDVCKF  180
EMIQRRPFSF TVTITRARNG PSEGVPCGNN VVKQKDIEGT SSGSRPKENF LDEGRDVMKH  240
NTLKVLVKNK APSVPKEFMK KGSNENIVEL KMGRKSWFVK VNYYESVHGW RFNKGWRKFM  300
EECKVEIGDT CLFNLIDERK FVFDVSIIGR TH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013466758.10.0B3 DNA-binding domain protein
TrEMBLA0A072VFJ20.0A0A072VFJ2_MEDTR; B3 DNA-binding domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11472624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.17e-08related to vernalization1 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]